Zhubajie.la valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title N/A
Description N/A
Keywords N/A
Server Information
WebSite zhubajie favicon www.zhubajie.la
Host IP N/A
Location N/A
Related Websites
Site Rank
More to Explore
000714.xyz
009bio.com
1314.in
404players.gitlab.io
4545.cf
521b210.xyz
acgcyk.net
aihisun.com
albarsha-massage.com
bilola.com
ridecarts.com
rosemarywhitepediatricservices.com
Zhubajie.la Valuation
US$2,921,174
Last updated: Aug 31, 2022

Zhubajie.la has global traffic rank of 30,185. Zhubajie.la has an estimated worth of US$ 2,921,174, based on its estimated Ads revenue. Zhubajie.la receives approximately 106,709 unique visitors each day. According to SiteAdvisor, zhubajie.la is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$2,921,174
Daily Ads Revenue US$1,600
Monthly Ads Revenue US$48,019
Yearly Ads Revenue US$584,234
Daily Unique Visitors 106,709
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 30,185
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
zhubajie.la NS 21600 Target: ns4.dnsv2.com.
zhubajie.la NS 21600 Target: ns3.dnsv2.com.
zhubajie.la SOA 180 MNAME: ns3.dnsv2.com.
RNAME: level3dnsadmin.dnspod.com.
Serial: 1657013837
Refresh: 3600
Retry: 180
Expire: 1209600
Minimum TTL: 180
HTTP Headers

                    
Zhubajie.la Whois Information
Domain Name: ZHUBAJIE.LA
Registry Domain ID: D728104-LANIC
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2020-08-14T09:59:48.0Z
Creation Date: 2010-12-24T08:00:13.0Z
Registry Expiry Date: 2022-12-24T23:59:59.0Z
Registrar: eNom, Inc.
Registrar IANA ID:
Domain Status: ok https://icann.org/epp#ok
Registrant Email: https://whois.nic.la/contact/zhubajie.la/registrant
Admin Email: https://whois.nic.la/contact/zhubajie.la/admin
Tech Email: https://whois.nic.la/contact/zhubajie.la/tech
Name Server: F1G1NS1.DNSPOD.NET
Name Server: F1G1NS2.DNSPOD.NET
DNSSEC: unsigned
Billing Email: https://whois.nic.la/contact/zhubajie.la/billing
Registrar Abuse Contact Email: abuse@centralnic.com
Registrar Abuse Contact Phone: +1.4252744500x4283
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

This whois service is provided by LANIC and only contains
information pertaining to Internet domain names registered by our
our customers. By using this service you are agreeing (1) not to use any
information presented here for any purpose other than determining
ownership of domain names, (2) not to store or reproduce this data in
any way, (3) not to use any high-volume, automated, electronic processes
to obtain data from this service. Abuse of this service is monitored and
actions in contravention of these terms will result in being permanently
blacklisted. All data is (c) LANIC http://www.lanic.gov.la/

Access to the whois service is rate limited. For more information, please
see https://registrar-console.lanic.la/pub/whois_guidance.